PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe5G269300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family MYB
Protein Properties Length: 256aa    MW: 28945.8 Da    PI: 8.7428
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe5G269300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-161865148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ed++l++++k++G g+W+  ++  g+ R++k+c++rw +yl
  Aqcoe5G269300.1.p 18 KGAWTEQEDQILINYIKLHGEGSWRQLPKAAGLLRCGKSCRLRWTNYL 65
                       79******************************99************97 PP

2Myb_DNA-binding60.73e-1971115147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg++T eEde++++++ ++G++ W++Ia++++ gRt++++k++w+++
  Aqcoe5G269300.1.p  71 RGNFTVEEDEIIIKLHSLHGNK-WSLIAERLP-GRTDNEIKNYWNTH 115
                        89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.5771365IPR017930Myb domain
SMARTSM007179.2E-141767IPR001005SANT/Myb domain
SuperFamilySSF466892.89E-3017112IPR009057Homeodomain-like
PfamPF002492.6E-151865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-221972IPR009057Homeodomain-like
CDDcd001676.36E-112065No hitNo description
PROSITE profilePS5129429.7466120IPR017930Myb domain
SMARTSM007171.5E-1870118IPR001005SANT/Myb domain
PfamPF002491.4E-1771115IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-2873120IPR009057Homeodomain-like
CDDcd001671.93E-1473116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MGRSPSLDKS SSHSHFNKGA WTEQEDQILI NYIKLHGEGS WRQLPKAAGL LRCGKSCRLR  60
WTNYLRPDLR RGNFTVEEDE IIIKLHSLHG NKWSLIAERL PGRTDNEIKN YWNTHIRRKL  120
LSQGLDPKTH LPINAIASDN KSRSNNSPIP IAAASKPTDD FITQDANDNR GIVRVPVQHH  180
QLPDLNLELS LHVSCQSSAE QEELKQKDSS YQVLMKPQPV QAVSHNVCLC CNLGLYGKEG  240
CKCQGANMDH LHRYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C8e-271612025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912520.18e-86PREDICTED: myb-related protein 308-like
SwissprotP813932e-78MYB08_ANTMA; Myb-related protein 308
TrEMBLQ6SL456e-86Q6SL45_TRAFL; MYB6
STRINGSb07g024890.17e-78(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.13e-74myb domain protein 7